SLC104 | |
Library | SL (Link to library) |
Clone ID | SLC104 (Link to dictyBase) |
Atlas ID | slc104 |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15892-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-A/SLC104Q.Seq.d/ |
Representative seq. ID | SLC104P (Link to Original site) |
Representative DNA sequence | >SLC104 (SLC104Q) /CSM/SL/SLC1-A/SLC104Q.Seq.d/ |
sequence update | 1999. 1.11 |
Translated Amino Acid sequence | ipcalyeklvisveassnirfklytinfvgspiryticsygl*tkgckiscfitllfvpf |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2009. 2.21 |
Homology vs Protein |
|
protein update | 2009. 6. 1 |
PSORT |
|
5' end seq. ID | SLC104F |
5' end seq. | >SLC104F.Seq |
Length of 5' end seq. | 642 |
3' end seq. ID | SLC104Z |
3' end seq. | >SLC104Z.Seq |
Length of 3' end seq. | 535 |
Connected seq. ID | SLC104P |
Connected seq. | >SLC104P.Seq |
Length of connected seq. | 1177 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |