SLA275 | |
Library | SL (Link to library) |
Clone ID | SLA275 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G01058 |
dictyBase ID | DDB0219866 |
Link to Contig | Contig-U01085-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-D/SLA275Q.Seq.d/ |
Representative seq. ID | SLA275P (Link to Original site) |
Representative DNA sequence | >SLA275 (SLA275Q) /CSM/SL/SLA2-D/SLA275Q.Seq.d/ |
sequence update | 1999. 1.12 |
Translated Amino Acid sequence | aisisllhefhmwnqiiflmiyllqqiqqnmv*ykkkkkn*titiiv*iiyniswymnly |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2009. 4. 4 |
Homology vs DNA |
|
dna update | 2004. 1. 8 |
Homology vs Protein | |
protein update | 2009. 5.31 |
PSORT |
|
5' end seq. ID | SLA275F |
5' end seq. | >SLA275F.Seq |
Length of 5' end seq. | 503 |
3' end seq. ID | SLA275Z |
3' end seq. | >SLA275Z.Seq |
Length of 3' end seq. | 719 |
Connected seq. ID | SLA275P |
Connected seq. | >SLA275P.Seq |
Length of connected seq. | 1222 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |