SHG152 | |
Library | SH (Link to library) |
Clone ID | SHG152 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U13024-1|Contig-U16344-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHG1-C/SHG152Q.Seq.d/ |
Representative seq. ID | SHG152P (Link to Original site) |
Representative DNA sequence | >SHG152 (SHG152Q) /CSM/SH/SHG1-C/SHG152Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | iqstnkkqqfkktiiyskvktikeslivffsssl*ipifffklissfsvflhnhnqpyii |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003.10. 9 |
Homology vs DNA |
|
dna update | 2006. 3.26 |
Homology vs Protein |
|
protein update | 2008.11.17 |
PSORT |
|
5' end seq. ID | SHG152F |
5' end seq. | >SHG152F.Seq |
Length of 5' end seq. | 306 |
3' end seq. ID | SHG152Z |
3' end seq. | >SHG152Z.Seq |
Length of 3' end seq. | 834 |
Connected seq. ID | SHG152P |
Connected seq. | >SHG152P.Seq |
Length of connected seq. | 1120 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |