CHP632 | |
Library | CH (Link to library) |
Clone ID | CHP632 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16510-1|Contig-U16524-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP6-B/CHP632Q.Seq.d/ |
Representative seq. ID | CHP632P (Link to Original site) |
Representative DNA sequence | >CHP632 (CHP632Q) /CSM/CH/CHP6-B/CHP632Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | cwptgkkifnsviiiikiitiirnynqiii*l*siitivklrihi*iiiiiivfknk*IN |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2009. 4. 4 |
Homology vs DNA |
|
dna update | 2003. 4.24 |
Homology vs Protein |
|
protein update | 2009. 4.11 |
PSORT |
|
5' end seq. ID | CHP632F |
5' end seq. | >CHP632F.Seq |
Length of 5' end seq. | 204 |
3' end seq. ID | CHP632Z |
3' end seq. | >CHP632Z.Seq |
Length of 3' end seq. | 220 |
Connected seq. ID | CHP632P |
Connected seq. | >CHP632P.Seq |
Length of connected seq. | 404 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |