CHP553 | |
Library | CH (Link to library) |
Clone ID | CHP553 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16333-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP5-C/CHP553Q.Seq.d/ |
Representative seq. ID | CHP553P (Link to Original site) |
Representative DNA sequence | >CHP553 (CHP553Q) /CSM/CH/CHP5-C/CHP553Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | llaywxf*ni*kifi***IKMKEYKKIILYSFLVFLILCFAKPSLSDDPLTTSTTTTTAT |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2005.10. 4 |
Homology vs Protein |
|
protein update | 2009. 4.11 |
PSORT |
|
5' end seq. ID | CHP553F |
5' end seq. | >CHP553F.Seq |
Length of 5' end seq. | 522 |
3' end seq. ID | CHP553Z |
3' end seq. | >CHP553Z.Seq |
Length of 3' end seq. | 458 |
Connected seq. ID | CHP553P |
Connected seq. | >CHP553P.Seq |
Length of connected seq. | 960 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |