CHP189 | |
Library | CH (Link to library) |
Clone ID | CHP189 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | - |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP1-D/CHP189Q.Seq.d/ |
Representative seq. ID | CHP189P (Link to Original site) |
Representative DNA sequence | >CHP189 (CHP189Q) /CSM/CH/CHP1-D/CHP189Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | llaywxllyiiflniyiniy*YININKMKILYSLLLISSIILNTVLNISSQVYDQRILAL |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2009. 4. 4 |
Homology vs DNA |
|
dna update | 2005. 9.18 |
Homology vs Protein |
|
protein update | 2009. 4.10 |
PSORT |
|
5' end seq. ID | CHP189F |
5' end seq. | >CHP189F.Seq |
Length of 5' end seq. | 667 |
3' end seq. ID | CHP189Z |
3' end seq. | >CHP189Z.Seq |
Length of 3' end seq. | 739 |
Connected seq. ID | CHP189P |
Connected seq. | >CHP189P.Seq |
Length of connected seq. | 1386 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |