CHP119 | |
Library | CH (Link to library) |
Clone ID | CHP119 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16361-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP1-A/CHP119Q.Seq.d/ |
Representative seq. ID | CHP119P (Link to Original site) |
Representative DNA sequence | >CHP119 (CHP119Q) /CSM/CH/CHP1-A/CHP119Q.Seq.d/ |
sequence update | 2002.10.25 |
Translated Amino Acid sequence | tvglldnnnnntniykfnfls*KIMDRNEGGDFPINTPNNINSSGGSYNNSMNNSSNNIG |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2005. 9.15 |
Homology vs Protein |
|
protein update | 2009. 4.10 |
PSORT |
|
5' end seq. ID | CHP119F |
5' end seq. | >CHP119F.Seq |
Length of 5' end seq. | 671 |
3' end seq. ID | CHP119Z |
3' end seq. | >CHP119Z.Seq |
Length of 3' end seq. | 693 |
Connected seq. ID | CHP119P |
Connected seq. | >CHP119P.Seq |
Length of connected seq. | 1344 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |